A1796
[KO Validated] CSNK1E Rabbit polyclonal antibody

Size
POA
- SKU:
- A1796
- Additional Names:
- 1E|CKIe|CKIepsilon|HCKIE
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 47kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- EFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGAARNPEDVDRERREHEREERMGQLRGSATRALPPGPPTGATANRLRSAAEPVASTPASRIQPAGNTSPRAISRVDRERKVSMRLHRGAPANVSSSDLTGRQEVSRIPASQTSVPFDHLGK
- Uniprot:
- P49674
- Synonyms:
- casein kinase I isoform epsilon;CKI-epsilon;CKIe;CKIepsilon;HCKIE;LOC400927-CSNK1E;LOC400927-CSNK1E readthrough
- Extra Details:
- The protein encoded by this gene is a serine/threonine protein kinase and a member of the casein kinase I protein family, whose members have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair. The encoded protein is found in the cytoplasm as a monomer and can phosphorylate a variety of proteins, including itself. This protein has been shown to phosphorylate period, a circadian rhythm protein. Two transcript variants encoding the same protein have been found for this gene.
- Shipping Conditions:
- Blue Ice
![[KO Validated] CSNK1E Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1796/A1796_1.jpg)
![[KO Validated] CSNK1E Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1796/A1796_2.jpg)
![[KO Validated] CSNK1E Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1796/A1796_3.jpg)
![[KO Validated] CSNK1E Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1796/A1796_P2032_WB_01.jpg)
![[KO Validated] CSNK1E Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1796/A1796_P2032_KO-WB_01.jpg)
![[KO Validated] CSNK1E Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1796/A1796_P2032_IF_01.jpg)