A17951
NIPSNAP1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A17951
- Additional Names:
- NIPSNAP1
- Application:
- ELISA, WB
- Molecular Weight:
- 29kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- NLYKIQFHNVKPEYLDAYNSLTEAVLPKLHLDEDYPCSLVGNWNTWYGEQDQAVHLWRFSGGYPALMDCMNKLKNN
- Uniprot:
- Q9BPW8
- Synonyms:
- 4-nitrophenylphosphatase domain and non-neuronal SNAP25-like 1;protein NipSnap homolog 1
- Extra Details:
- This gene encodes a member of the NipSnap family of proteins that may be involved in vesicular transport. A similar protein in mice inhibits the calcium channel TRPV6, and is also localized to the inner mitochondrial membrane where it may play a role in mitochondrial DNA maintenance. A pseudogene of this gene is located on the short arm of chromosome 17. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
- Shipping Conditions:
- Blue Ice