PXDN Rabbit polyclonal antibody

Size

£152.00

SKU:: A17929
Additional Names:: ASGD7|COPOA|D2S448|D2S448E|hsPxd01|MG50|PRG2|PXDN|PXN|VPO
Application:: ELISA, WB
Molecular Weight:: 165 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: RTRGQFNAFSYHFRGRRSLEFSYQEDKPTKKTRPRKIPSVGRQGEHLSNSTSAFSTRSDASGTNDFREFVLEMQKTITDLRTQIKKLESRLSTTECVDAGGESHANNTKWKKDACTICECKDGQVTCFVEACPPATCAVPVNIPGACCPVCLQKRAEEKP
Uniprot:: Q92626
Synonyms:: ASGD7;COPOA;D2S448;D2S448E;melanoma-associated antigen MG50;MG50;p53-responsive gene 2 protein;peroxidasin homolog;PRG2;PXN;vascular peroxidase 1;VPO
Extra Details:: This gene encodes a heme-containing peroxidase that is secreted into the extracellular matrix. It is involved in extracellular matrix formation, and may function in the physiological and pathological fibrogenic response in fibrotic kidney. Mutations in this gene cause corneal opacification and other ocular anomalies, and also microphthalmia and anterior segment dysgenesis.