[KO Validated] APP Rabbit monoclonal antibody

Size

POA

SKU:: A17911
Additional Names:: AAA|ABETA|ABPP|AD1|alpha-sAPP|APPI|CTFgamma|CVAP|PN-II|PN2|PP|preA4
Application:: ELISA, WB, IHC-P, IF, ICC, IP
Molecular Weight:: 100-140kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
Uniprot:: P05067
Synonyms:: AAA;ABETA;ABPP;AD1;alpha-sAPP;alzheimer disease amyloid protein;amyloid beta (A4) precursor protein;amyloid beta A4 protein;amyloid precursor protein;amyloid-beta precursor protein;APPI;beta-amyloid peptide;beta-amyloid peptide(1-40);beta-amyloid peptide(1-42);beta-amyloid precursor protein;cerebral vascular amyloid peptide;CTFgamma;CVAP;peptidase nexin-II;PN-II;PN2;preA4;protease nexin-II;testicular tissue protein Li 2
Extra Details:: This gene encodes a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. In addition, two of the peptides are antimicrobial peptides, having been shown to have bacteriocidal and antifungal activities. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene.

Shipping Conditions:: Blue Ice