ZBTB8A Rabbit polyclonal antibody

Size

£152.00

SKU:: A17885
Additional Names:: BOZF1|ZBTB8|ZBTB8A|ZNF916A
Application:: ELISA, WB
Molecular Weight:: 50kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: HEPRKESIKKTKHLRLSQPSEVTHYKSSKREVRTSDSSSHVSQSEEQAQIDAEMDSTPVGYQYGQGSDVTSKSFPDDLPRMRFKCPYCTHVVKRKADLKRHLRCHTGERPYPCQACGKRFSRLDHLSSHFRTIHQACKLICRKCKRHVTDLTGQVVQEGTRRYRLCNECLAEFGIDSLPIDLEAEQHLMSPSDGDKDSRWH
Uniprot:: Q96BR9
Synonyms:: BOZF1;BTB/POZ and zinc-finger domain-containing factor;BTB/POZ and zinc-finger domains factor on chromosome 1;ZBTB8;zinc finger and BTB domain containing 8;zinc finger and BTB domain-containing protein 8A;ZNF916A
Extra Details:: Predicted to enable RNA polymerase II transcription regulatory region sequence-specific DNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to be active in nucleus.