Enpp1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A17876
Additional Names:: 4833416E15Rik|CD203c|E-NPP 1|E-NPP1|Enpp1|Ly-41|M6S1|NPP1|Npps|PC-1|Pca|Pca-1|Pdnp1|ttw|twy
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 120kDa/170kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: PIYNPSHPKEEGFLSQCPIKSTSNDLGCTCDPWIVPIKDFEKQLNLTTEDDDIYHMTVPYGRPRILLKQHRVCLLQQQQFLTGYSLDLLMPLWASYTFLSNDQFSRDDFSNCLYQDLRIPLSPVHKCSYYKSNSKLSYGFLTPPRLNRVSN
Uniprot:: G3X9S2
Synonyms:: 4833416E15Rik;AI428932;alkaline phosphodiesterase 1;ARHR2;C76301;CD203c;COLED;E-N;E-NPP 1;E-NPP1;ectonucleotide pyrophosphatase/phosphodiesterase family member 1;Ly-4;Ly-41;Ly-41 antigen;lymphocyte antigen 41;M6S1;membrane component, chromosome 6, surface marker 1;N;NPP1;NPPS;P;PC-;PC-1;Pca;Pca-1;PCA1;Pd;PDNP1;phosphodiesterase I/nucleotide pyrophosphatase 1;plasma-cell membrane glycoprotein 1;plasma-cell membrane glycoprotein PC-1;tiptoe walking;ttw;twy
Extra Details:: This gene encodes a member of the nucleoside pyrophosphatase/phosphodiesterase family of enzymes that catalyzes the hydrolysis of pyrophosphate and phosphodiester bonds in nucleotide triphosphates and oligonucleotides, respectively, to generate nucleoside 5'-monophosphates. The encoded protein is a type II transmembrane glycoprotein that negatively regulates bone mineralization. Mice harboring a nonsense mutation in this gene, termed tiptoe walking (ttw), exhibit ectopic ossification of the spinal ligaments. The encoded protein binds to the insulin receptor, inhibits downstream signaling events and induces insulin resistance and glucose tolerance. This gene is located adjacent to a paralog on chromosome 10. Alternative splicing results in multiple transcript variants encoding different isoforms.

Shipping Conditions:: Blue Ice