CYP7B1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A17872
Additional Names:: CBAS3|CP7B|CYP7B1|SPG5A
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 55kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAGEVSAATGRFSLERLGLPGLALAAALLLLALCLLVRRTRRPGEPPLIKGWLPYLGVVLNLRKDPLRFMKTLQKQHGDTFTVLLGGKYITFILDPFQYQ
Uniprot:: O75881
Synonyms:: 24-hydroxycholesterol 7-alpha-hydroxylase;25-hydroxycholesterol 7-alpha-hydroxylase;25/26-hydroxycholesterol 7-alpha-hydroxylase;3-hydroxysteroid 7-alpha hydroxylase;CBAS3;CP7B;cytochrome P450 7B1;cytochrome P450, subfamily VIIB (oxysterol 7 alpha-hydroxylase), polypeptide 1;oxysterol 7-alpha-hydroxylase;SPG5A
Extra Details:: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum membrane protein catalyzes the first reaction in the cholesterol catabolic pathway of extrahepatic tissues, which converts cholesterol to bile acids. This enzyme likely plays a minor role in total bile acid synthesis, but may also be involved in the development of atherosclerosis, neurosteroid metabolism and sex hormone synthesis. Mutations in this gene have been associated with hereditary spastic paraplegia (SPG5 or HSP), an autosomal recessive disorder.

Shipping Conditions:: Blue Ice