USP12 Rabbit polyclonal antibody

Size

£152.00

SKU:: A17862
Additional Names:: UBH1|USP12|USP12L1
Application:: ELISA, WB
Molecular Weight:: 42kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MEILMTVSKFASICTMGANASALEKEIGPEQFPVNEHYFGLVNFGNTCYCNSVLQALYFCRPFREKVLAYKSQPRKKESLLTCLADLFHSIATQKKKVGV
Uniprot:: O75317
Synonyms:: deubiquitinating enzyme 12;UBH1;ubiquitin carboxyl-terminal hydrolase 12;ubiquitin specific protease 12 like 1;ubiquitin thioesterase 12;ubiquitin thiolesterase 12;ubiquitin-hydrolyzing enzyme 1;ubiquitin-specific-processing protease 12;USP12L1
Extra Details:: Enables cysteine-type endopeptidase activity and thiol-dependent deubiquitinase. Involved in protein deubiquitination. Predicted to be located in nucleoplasm. Predicted to be active in cytosol and nucleus.