A17853
VWC2L Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A17853
- Additional Names:
- A830006F12Rik|Brl|VWC2L
- Application:
- ELISA, WB
- Molecular Weight:
- 23kDa
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MALHIHEACILLLVIPGLVTSAAISHEDYPADEGDQASSNDNLIFDDYRG
- Uniprot:
- Q505H4
- Synonyms:
- A830006F12Rik;B;Brl;bror;Brorin-like;von Willebrand factor C domain containing protein 2 like;von Willebrand factor C domain-containing protein 2-like
- Extra Details:
- Acts upstream of or within negative regulation of BMP signaling pathway and positive regulation of neuron differentiation. Located in extracellular space. Part of AMPA glutamate receptor complex. Is expressed in brain; central nervous system; hippocampus; hypothalamus; and thalamus. Orthologous to human VWC2L (von Willebrand factor C domain containing 2 like).
- Shipping Conditions:
- Blue Ice