A17851
LIN9 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A17851
- Additional Names:
- BARA|BARPsv|Lin-9|LIN9|TGS|TGS1|TGS2
- Application:
- ELISA, WB
- Molecular Weight:
- 70kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- TLGGFPVEFLIQVTRLSKILMIKKEHIKKLREMNTEAEKLKSYSMPISIEFQRRYATIVLELEQLNKDLNKVLHKVQQYCYELAPDQGLQPADQPTDMRRRCEEEAQEIVRHANSSTGQPC
- Uniprot:
- Q5TKA1
- Synonyms:
- BARA;BARPsv;beta subunit-associated regulator of apoptosis;Lin-9;lin-9 homolog;pRB-associated protein;protein lin-9 homolog;rb related pathway actor;TGS;TGS1;TGS2;TUDOR gene similar protein;type I interferon receptor beta chain-associated protein
- Extra Details:
- This gene encodes a tumor suppressor protein that inhibits DNA synthesis and oncogenic transformation through association with the retinoblastoma 1 protein. The encoded protein also interacts with a complex of other cell cycle regulators to repress cell cycle-dependent gene expression in non-dividing cells. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
- Shipping Conditions:
- Blue Ice