MIB2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A17829
Additional Names:: MIB2|ZZANK1|ZZZ5
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 110kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ASVTWADGTTNVYRVGHKGKVDLKCVGEAAGGFYYKDHLPRLGKPAELQRRVSADSQPFQHGDKVKCLLDTDVLREMQEGHGGWNPRMAEFIGQTGTVHRITDRGDVRVQFNHETRWTFHPGALTKHHSFWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRAQKSDPEHPGRLVVEVALGNAARALDLLRRRPEQVDTKNQGRTALQVAAYLGQVE
Uniprot:: Q96AX9
Synonyms:: E3 ubiquitin-protein ligase MIB2;mind bomb homolog 2;mindbomb E3 ubiquitin protein ligase 2;mindbomb homolog 2;novel zinc finger protein;novelzin;putative NF-kappa-B-activating protein 002N;RING-type E3 ubiquitin transferase MIB2;skeletrophin;zinc finger ZZ type with ankyrin repeat domain protein 1;zinc finger, ZZ type with ankyrin repeat domain 1;ZZANK1;ZZZ5
Extra Details:: The protein encoded by this gene is an E3 ubiquitin protein ligase that mediates ubiquitination of proteins in the Notch signaling pathway. The encoded protein may be a suppressor of melanoma invasion.