A17826
CLVS2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A17826
- Additional Names:
- bA160A10.4|C6orf212|C6orf213|CLVS2|RLBP1L2
- Application:
- ELISA, WB
- Molecular Weight:
- 38kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LLDHEYDDDSEYNVDSYSMPVKEVEKELSPKSMKRSQSVVDPTVLKRMDKNEEENMQPLLSLD
- Uniprot:
- Q5SYC1
- Synonyms:
- bA160A10.4;C6orf212;C6orf213;clathrin vesicle-associated Sec14 protein 2;clavesin-2;retinaldehyde binding protein 1-like 2;Retinaldehyde-binding protein 1-like 2;RLBP1L2
- Extra Details:
- This gene encodes a protein that belongs to the SEC14/CRAL-TRIO family of proteins. A similar protein in rat is thought to function in the endosomal pathway between early endosomes and mature lysosomes.
- Shipping Conditions:
- Blue Ice