ASB17 Rabbit polyclonal antibody

Size

£152.00

SKU:: A17822
Additional Names:: Asb-17|ASB17
Application:: ELISA, WB
Molecular Weight:: 34kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: PSLQFLGQWGYHCYEPRIYRSLAKILRYVDLDGFDALLTDYIAFVEKSGYRFEVSFNLDFTEICVNTILYWVFARKGNPDFVELLLKKTKDYVQDRSCNLA
Uniprot:: Q8WXJ9
Synonyms:: ankyrin repeat and SOCS box protein 17;Asb-17
Extra Details:: Predicted to be involved in intracellular signal transduction and protein ubiquitination. Predicted to be located in cytosol.