A1782
CTSK Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A1782
- Additional Names:
- CTS02|CTSK|CTSO|CTSO1|CTSO2|PKND|PYCD
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 26kDa/37kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
- Uniprot:
- P43235
- Synonyms:
- cathepsin K;cathepsin O;cathepsin O1;cathepsin O2;cathepsin X;CTS02;CTSO;CTSO1;CTSO2;PKND;PYCD
- Extra Details:
- The protein encoded by this gene is a lysosomal cysteine proteinase involved in bone remodeling and resorption. This protein, which is a member of the peptidase C1 protein family, is predominantly expressed in osteoclasts. However, the encoded protein is also expressed in a significant fraction of human breast cancers, where it could contribute to tumor invasiveness. Mutations in this gene are the cause of pycnodysostosis, an autosomal recessive disease characterized by osteosclerosis and short stature.
- Shipping Conditions:
- Blue Ice





