A17814
PGLYRP2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A17814
- Additional Names:
- HMFT0141|PGLYRP2|PGLYRPL|PGRP-L|PGRPL|tagL|tagL-alpha|tagl-beta|TAGL-like
- Application:
- ELISA, WB
- Molecular Weight:
- 62kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LSQYYGAGVARDPGFRSNFRRQNGAALTSASILAQQVWGTLVLLQRLEPVHLQLQCMSQEQLAQVAANATKEFTEAFLGCPAIHPRCRWGAAPYRGRPKLL
- Uniprot:
- Q96PD5
- Synonyms:
- HMFT0141;N-acetylmuramoyl-L-alanine amidase;Peptidoglycan recognition protein 2;peptidoglycan recognition protein L;peptidoglycan recognition protein long;PGLYRPL;PGRP-L;PGRPL;tagL;tagL-alpha;tagl-beta;TAGL-like
- Extra Details:
- This gene encodes a peptidoglycan recognition protein, which belongs to the N-acetylmuramoyl-L-alanine amidase 2 family. This protein hydrolyzes the link between N-acetylmuramoyl residues and L-amino acid residues in bacterial cell wall glycopeptides, and thus may play a scavenger role by digesting biologically active peptidoglycan into biologically inactive fragments.
- Shipping Conditions:
- Blue Ice