A1781
AKR1C3 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A1781
- Additional Names:
- AKR1C3|DD3|DDX|HA1753|HAKRB|HAKRe|hluPGFS|HSD17B5|PGFS
- Application:
- ELISA, WB, IF, ICC, IP
- Molecular Weight:
- 37kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY
- Uniprot:
- P42330
- Synonyms:
- 17-beta-hydroxysteroid dehydrogenase type 5;3-alpha hydroxysteroid dehydrogenase, type II;3-alpha-HSD type II, brain;3-alpha-hydroxysteroid dehydrogenase type 2;aldo-keto reductase family 1 member C3;chlordecone reductase homolog HAKRb;DD3;DDX;dihydrodiol dehydrogenase 3;Dihydrodiol dehydrogenase type I;dihydrodiol dehydrogenase X;HA1753;HAKRB;HAKRe;hluPGFS;HSD17B5;indanol dehydrogenase;PGFS;prostaglandin F synthase;testosterone 17-beta-dehydrogenase 5;trans-1,2-dihydrobenzene-1,2-diol dehydrogenase;type IIb 3-alpha hydroxysteroid dehydrogenase
- Extra Details:
- This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ), and the oxidation of 9alpha,11beta-PGF2 to PGD2. It may play an important role in the pathogenesis of allergic diseases such as asthma, and may also have a role in controlling cell growth and/or differentiation. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. Three transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice





