MARVELD1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A17787
Additional Names:: bA548K23.8|GB14|MARVD1|MARVELD1|MRVLDC1
Application:: ELISA, WB
Molecular Weight:: 19kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MLPPPPRQPPPQARAARGAVRLQRPFLRSPLGVLRLLQLLAGAAFWITIA
Uniprot:: Q9BSK0
Synonyms:: bA548K23.8;GB14;MARVD1;MARVEL (membrane-associating) domain containing 1;MARVEL domain-containing protein 1;MRVLDC1;occludin;putative MARVEL domain-containing protein 1
Extra Details:: Predicted to be a structural constituent of myelin sheath. Predicted to be involved in myelination. Predicted to be located in several cellular components, including cytoskeleton; nucleus; and plasma membrane. Predicted to be integral component of membrane.