A1778
CD82 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A1778
- Additional Names:
- 4F9|C33|CD82|GR15|IA4|KAI1|R2|SAR2|ST6|TSPAN27
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 45kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- CGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSI
- Uniprot:
- P27701
- Synonyms:
- 4F9;C33;C33 antigen;CD82 antigen;GR15;IA4;inducible membrane protein R2;KAI1;kangai 1 (suppression of tumorigenicity 6, prostate; CD82 antigen (R2 leukocyte antigen, antigen detected by monoclonal and antibody IA4));metastasis suppressor Kangai-1;R2;SAR2;ST6;Suppressor of tumorigenicity 6 protein;tetraspanin-27;tspan-27;TSPAN27
- Extra Details:
- This metastasis suppressor gene product is a membrane glycoprotein that is a member of the transmembrane 4 superfamily. Expression of this gene has been shown to be downregulated in tumor progression of human cancers and can be activated by p53 through a consensus binding sequence in the promoter. Its expression and that of p53 are strongly correlated, and the loss of expression of these two proteins is associated with poor survival for prostate cancer patients. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice







