A17776
DCAF17 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A17776
- Additional Names:
- C20orf37|C2orf37|DCAF17
- Application:
- ELISA, WB
- Molecular Weight:
- 59kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LYSFQTIAEQFMQQKLDLGCACRWGGTTGTVGEAPFGIPCNIKITDMPPLLFEVSSLENAFQIGGHPWHYIVTPNKKKQKGVFHICALKDNSLAKNGIQEM
- Uniprot:
- Q5H9S7
- Synonyms:
- C20orf37;C2orf37;DDB1- and CUL4-associated factor 17
- Extra Details:
- This gene encodes a nuclear transmembrane protein that associates with cullin 4A/damaged DNA binding protein 1 ubiquitin ligase complex. Mutations in this gene are associated with Woodhouse-Sakati syndrome. Alternate splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice