A1776
GGT1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A1776
- Additional Names:
- CD224|D22S672|D22S732|GGT|GGT 1|GGT1|GGTD|GTG
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 25KDa/75KDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- KPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITTATALAIIYNLWFGYDVKRAVEEPRLHNQLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSRKGGEPAGY
- Uniprot:
- P19440
- Synonyms:
- CD224;D22S672;D22S732;Gamma-glutamyltransferase 1;gamma-glutamyltranspeptidase 1;GGT;GGT 1;GGTD;glutathione hydrolase 1 proenzyme;GTG;leukotriene-C4 hydrolase;testicular tissue protein Li 73
- Extra Details:
- The enzyme encoded by this gene is a type I gamma-glutamyltransferase that catalyzes the transfer of the glutamyl moiety of glutathione to a variety of amino acids and dipeptide acceptors. The enzyme is composed of a heavy chain and a light chain, which are derived from a single precursor protein. It is expressed in tissues involved in absorption and secretion and may contribute to the etiology of diabetes and other metabolic disorders. Multiple alternatively spliced variants have been identified. There are a number of related genes present on chromosomes 20 and 22, and putative pseudogenes for this gene on chromosomes 2, 13, and 22.
- Shipping Conditions:
- Blue Ice