A17730
UTP6 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A17730
- Additional Names:
- C17orf40|HCA66|UTP6
- Application:
- ELISA, WB
- Molecular Weight:
- 70kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAEIIQERIEDRLPELEQLERIGLFSHAEIKAIIKKASDLEYKIQRRTLFKEDFINYVQYEINLLELIQRRRTRIGYSFKKDEIENSIVHRVQGVFQRASAKWKDDVQLWLSYVAFCKKWATKTRLSKVFSAMLAIHSNKPALWIMAAKWEMEDRLSSESARQLFLRALRFHPECPKLYKEYFRMELMHAEKLRKEKEEFEKASMDVENPDYSEEILKGE
- Uniprot:
- Q9NYH9
- Synonyms:
- C17orf40;HCA66;hepatocellular carcinoma-associated antigen 66;multiple hat domains protein;U3 small nucleolar RNA-associated protein 6 homolog;UTP6, small subunit (SSU) processome component, homolog
- Extra Details:
- Predicted to enable snoRNA binding activity. Predicted to be involved in maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA). Located in chromosome and nucleolus.
- Shipping Conditions:
- Blue Ice