A17712
ELOVL2 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A17712
- Additional Names:
- ELOVL2|SSC2
- Application:
- ELISA, WB
- Molecular Weight:
- 38kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ILFLNFYVQTYRKKPMKKDMQEPPAGKEVKNGFSKAYFTAANGVMNKKAQ
- Uniprot:
- Q9NXB9
- Synonyms:
- 3-keto acyl-CoA synthase ELOVL2;elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 2;elongation of very long chain fatty acids protein 2;ELOVL FA elongase 2;ELOVL fatty acid elongase 2;SSC2;very long chain 3-ketoacyl-CoA synthase 2;very long chain 3-oxoacyl-CoA synthase 2
- Extra Details:
- Enables fatty acid elongase activity. Involved in fatty acid elongation, polyunsaturated fatty acid and very long-chain fatty acid biosynthetic process. Located in endoplasmic reticulum.
- Shipping Conditions:
- Blue Ice

