A17700
RSL24D1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A17700
- Additional Names:
- C15orf15|HRP-L30-iso|L30|RLP24|RPL24|RPL24L|RSL24D1|TVAS3
- Application:
- ELISA, WB
- Molecular Weight:
- 20kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPIK
- Uniprot:
- Q9UHA3
- Synonyms:
- 60S ribosomal protein L30 isolog;C15orf15;homolog of yeast ribosomal like protein 24;HRP-L30-iso;L30;my024 protein;probable ribosome biogenesis protein RLP24;ribosomal L24 domain-containing protein 1;Ribosomal protein L24-like;RLP24;RPL24;RPL24L;TVAS3
- Extra Details:
- This gene encodes a protein sharing a low level of sequence similarity with human ribosomal protein L24. Although this gene has been referred to as RPL24, L30, and 60S ribosomal protein L30 isolog in the sequence databases, it is distinct from the human genes officially named RPL24 (which itself has been referred to as ribosomal protein L30) and RPL30. The protein encoded by this gene localizes to the nucleolus and is thought to play a role in the biogenesis of the 60S ribosomal subunit. The precise function of this gene is currently unknown. This gene utilizes alternative polyadenylation signals and has multiple pseudogenes.
- Shipping Conditions:
- Blue Ice

