TRNT1 Rabbit polyclonal antibody

Size

POA

SKU:: A17699
Additional Names:: CCA1|CGI-47|MtCCA|RPEM|SIFD|TRNT1
Application:: ELISA, WB
Molecular Weight:: 50kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: HAEVEFTTDWQKDAERRDLTINSMFLGFDGTLFDYFNGYEDLKNKKVRFVGHAKQRIQEDYLRILRYFRFYGRIVDKPGDHDPETLEAIAENAKGLAGISGERIWVELKKILVGNHVNHLIHLIYDLDVAPYIGLPANASLEEFDKVSKNVDGFSPKPVTLLASLFKVQDDVTKLDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQDFIIDSREPDATTRVCELLKYQGEHCLLKEMQQWSIPPFPVSGHDIRKVGISSGKEIGALLQQLREQWKKSGYQMEKDELLSYIKKT
Uniprot:: Q96Q11
Synonyms:: ATP(CTP):tRNA nucleotidyltransferase;CCA tRNA nucleotidyltransferase 1, mitochondrial;CCA-adding enzyme;CCA1;CGI-47;mitochondrial CCA-adding tRNA-nucleotidyltransferase;Mitochondrial tRNA nucleotidyl transferase, CCA-adding;mt CCA-adding enzyme;mt tRNA adenylyltransferase;mt tRNA CCA-diphosphorylase;mt tRNA CCA-pyrophosphorylase;MtCCA;RPEM;SIFD;tRNA CCA nucleotidyl transferase 1;tRNA nucleotidyl transferase, CCA-adding, 1;tRNA-nucleotidyltransferase 1, mitochondrial
Extra Details:: The protein encoded by this gene is a CCA-adding enzyme which belongs to the tRNA nucleotidyltransferase/poly(A) polymerase family. This essential enzyme functions by catalyzing the addition of the conserved nucleotide triplet CCA to the 3' terminus of tRNA molecules. Mutations in this gene result in sideroblastic anemia with B-cell immunodeficiency, periodic fevers, and developmental delay. Alternative splicing results in multiple transcript variants.

Shipping Conditions:: Blue Ice