A17690
NOB1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A17690
- Additional Names:
- ART-4|MST158|MSTP158|NOB1|NOB1P|PSMD8BP1
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 47kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAPVEHVVADAGAFLRHAALQDIGKNIYTIREVVTEIRDKATRRRLAVLPYELRFKEPLPEYVRLVTEFSKKTGDYPSLSATDIQVLALTYQLEAEFVGVSHLKQEPQKVKVSSSIQHPETPLHISGFHLPYKPKPPQETEKGHSACEPENLEFSSFMFWRNPLPNIDHELQELLIDRGEDVPSEEEEEEENGFEDRKDDSDDDGGGWITPSNIKQIQQELEQCDVPEDV
- Uniprot:
- Q9ULX3
- Synonyms:
- adenocarcinoma antigen recognized by T lymphocytes 4;ART-4;MST158;MSTP158;nin one binding protein;NIN1/PSMD8 binding protein 1 homolog;NOB1P;phosphorylation regulatory protein HP-10;protein ART-4;PSMD8 binding protein 1;PSMD8BP1;RNA-binding protein NOB1
- Extra Details:
- In yeast, over 200 protein and RNA cofactors are required for ribosome assembly, and these are generally conserved in eukaryotes. These factors orchestrate modification and cleavage of the initial 35S precursor rRNA transcript into the mature 18S, 5.8S, and 25S rRNAs, folding of the rRNA, and binding of ribosomal proteins and 5S RNA. Nob1 is involved in pre-rRNA processing. In a late cytoplasmic processing step, Nob1 cleaves a 20S rRNA intermediate at cleavage site D to produce the mature 18S rRNA (Lamanna and Karbstein, 2009 [PubMed 19706509]).
- Shipping Conditions:
- Blue Ice







