ABHD12 Rabbit polyclonal antibody

Size

£152.00

SKU:: A17678
Additional Names:: ABHD12|ABHD12A|BEM46L2|C20orf22|dJ965G21.2|hABHD12|PHARC
Application:: ELISA, WB
Molecular Weight:: 45kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: YFIDLKKPQDQGLNHTCNYYLQPEEDVTIGVWHTVPAVWWKNAQGKDQMWYEDALASSHPIILYLHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGDSVGTPSERGMTYDALHVFDWIKARSGDNPVYIWGHSLGTG
Uniprot:: Q8N2K0
Synonyms:: 2-arachidonoylglycerol hydrolase;2-arachidonoylglycerol hydrolase ABHD12;ABHD12A;abhydrolase domain-containing protein 12;BEM46L2;C20orf22;dJ965G21.2;hABHD12;lysophosphatidylserine lipase ABHD12;monoacylglycerol lipase ABHD12;oxidized phosphatidylserine lipase ABHD12;PHARC
Extra Details:: This gene encodes an enzyme that catalyzes the hydrolysis of 2-arachidonoyl glycerol (2-AG), the main endocannabinoid lipid transmitter that acts on cannabinoid receptors, CB1 and CB2. The endocannabinoid system is involved in a wide range of physiological processes, including neurotransmission, mood, appetite, pain appreciation, addiction behavior, and inflammation. Mutations in this gene are associated with the neurodegenerative disease, PHARC (polyneuropathy, hearing loss, ataxia, retinitis pigmentosa, and cataract), resulting from an inborn error of endocannabinoid metabolism. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.

Shipping Conditions:: Blue Ice