A17669
RAB3GAP2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A17669
- Additional Names:
- MARTS1|p150|RAB3-GAP150|RAB3GAP150|RAB3GAP2|SPG69|WARBM2
- Application:
- ELISA, WB
- Molecular Weight:
- 156kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MACSIVQFCYFQDLQAARDFLFPHLREEILSGALRRDPSKSTDWEDDGWGAWEENEPQEPEEEGNTCKTQKTSWLQDCVLSLSPTNDLMVIAREQKAVFLVPKWKYSDKGKEEMQFAVGWSGSLNVEEGECVTSALCIPLASQKRSSTGRPDWTCIVVGFTSGYVRFYTENGVLLLAQLLNEDPVLQLKCRTYEIPRHPG
- Uniprot:
- Q9H2M9
- Synonyms:
- MARTS1;p150;RAB3 GTPase activating protein subunit 2 (non-catalytic);rab3 GTPase-activating protein 150 kDa subunit;rab3 GTPase-activating protein non-catalytic subunit;rab3-GAP p150;rab3-GAP regulatory subunit;RAB3-GAP150;RAB3GAP150;RGAP-iso;SPG69;WARBM2
- Extra Details:
- The protein encoded by this gene belongs to the RAB3 protein family, members of which are involved in regulated exocytosis of neurotransmitters and hormones. This protein forms the Rab3 GTPase-activating complex with RAB3GAP1, where it constitutes the regulatory subunit, whereas the latter functions as the catalytic subunit. This gene has the highest level of expression in the brain, consistent with it having a key role in neurodevelopment. Mutations in this gene are associated with Martsolf syndrome.
- Shipping Conditions:
- Blue Ice