A17657
RTF1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A17657
- Additional Names:
- GTL7|KIAA0252|RTF1
- Application:
- ELISA, WB
- Molecular Weight:
- 100kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LAKKQPLKTSEVYSDDEEEEEDDKSSEKSDRSSRTSSSDEEEEKEEIPPKSQPVSLPEELNRVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNHNSKPVY
- Uniprot:
- Q92541
- Synonyms:
- GTL7;KIAA0252;ortholog of mouse gene trap locus 7;RNA polymerase-associated protein RTF1 homolog;Rtf1, Paf1/RNA polymerase II complex component, homolog
- Extra Details:
- This locus may represent a gene involved in regulation of transcription elongation and chromatin remodeling, based on studies of similar proteins in other organisms. The encoded protein may bind single-stranded DNA.
- Shipping Conditions:
- Blue Ice