SCNN1B Rabbit polyclonal antibody

Size

£152.00

SKU:: A1765
Additional Names:: BESC1|beta-ENaC|beta-NaCH|ENaCb|ENaCbeta|LIDLS1|PHA1B2|SCNEB|SCNN1B
Application:: ELISA, WB
Molecular Weight:: 75kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: YPLPRGEKYCNNRDFPDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLSQERDQSTNITLSRKGIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWITIIKLVALAKSLRQRRAQASYAGPPPTVAELVEAHTNFGFQPDTAPRSPNTGPYPSEQALPIPGTPPPNYDSLRLQPLDVIESDSEGDAI
Uniprot:: P51168
Synonyms:: amiloride-sensitive sodium channel subunit beta;amiloride-sensitive sodium channel subunit beta 1;BESC1;beta-ENaC;beta-NaCH;ENaCb;ENaCbeta;epithelial Na(+) channel subunit beta;epithelial sodium channel beta-2 subunit;epithelial sodium channel beta-3 subunit;LIDLS1;mutant sodium channel epithelial 1 beta subunit;nasal epithelial sodium channel beta subunit;nonvoltage-gated sodium channel 1 subunit beta;SCNEB;sodium channel epithelial 1 beta subunit;sodium channel, non-voltage-gated 1, beta subunit
Extra Details:: Nonvoltage-gated, amiloride-sensitive, sodium channels control fluid and electrolyte transport across epithelia in many organs. These channels are heteromeric complexes consisting of 3 subunits: alpha, beta, and gamma. This gene encodes the beta subunit, and mutations in this gene have been associated with pseudohypoaldosteronism type 1 (PHA1), and Liddle syndrome.

Shipping Conditions:: Blue Ice