A17647
PCNX1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A17647
- Additional Names:
- PCNX|PCNX1|PCNXL1|pecanex
- Application:
- ELISA, WB
- Molecular Weight:
- 290kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- VDPSQILEGINLSKRKELQWPDEGIRLKAGRNSWKDWSPQEGMEGHVIHRWVPCSRDPGTRSHIDKAVLLVQIDDKYVTVIETGVLELGAEV
- Uniprot:
- Q96RV3
- Synonyms:
- PCNX;PCNXL1;pecanex;pecanex homolog 1;Pecanex homolog protein 1;pecanex-like protein 1
- Extra Details:
- This gene encodes an evolutionarily conserved transmembrane protein similar to the pecanex protein in Drosophila. The fly protein is a component of the Notch signaling pathway, which functions in several developmental processes.
- Shipping Conditions:
- Blue Ice