A17637
HSPA4L Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A17637
- Additional Names:
- APG-1|APG1|HSPA4L|HSPH3|Osp94
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 115kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- KQNLEGDHSDAPMETETSFKNENKDNMDKMQVDQEEGHQKCHAEHTPEEEIDHTGAKTKSAVSDKQDRLNQTLKKGKVKSIDLPIQSSLCRQLGQDLLNSY
- Uniprot:
- O95757
- Synonyms:
- APG-1;APG1;heat shock 70 kDa protein 4-like protein;heat shock 70 kDa protein 4L;heat shock 70-related protein APG-1;heat shock 70kDa protein 4-like;heat shock protein (hsp110 family);heat-shock protein family A member 4-like protein;HSPA4-like protein;HSPH3;osmotic stress protein 94;Osp94;testis tissue sperm-binding protein Li 64n
- Extra Details:
- The protein encoded by this gene is heat shock inducible and may act as a chaperone. The encoded protein can protect the heat-shocked cell against the harmful effects of aggregated proteins. This gene is highly expressed in leukemia cells and may be a good target for therapeutic intervention. Several transcripts encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice