BAZ2A Rabbit polyclonal antibody

Size

£152.00

SKU:: A17630
Additional Names:: BAZ2A|TIP5|WALp3
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 280-310kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: QYPSANPGSNLKDPPLLSQFSGGQYPLNGILGGSRQPSSPSHNTNLRAGSQEFWANGTQSPMGLNFDSQELYDSFPDQNFEVMPNGPPSFFTSPQTSPMLGSSIQTFAPSQEVGSGIHPDEAAEKEMTSVVAENGTGLVGSLELEEEQPELKMCGYNGSVPSVESLHQEVSVLVPDPTVSCLDDPSHLPDQLEDTPILS
Uniprot:: Q9UIF9
Synonyms:: bromodomain adjacent to zinc finger domain protein 2A;hWALp3;TIP5;transcription termination factor I-interacting protein 5;TTF-I interacting peptide 5;TTF-I-interacting protein 5;WALp3
Extra Details:: Enables histone binding activity. Contributes to RNA polymerase I core promoter sequence-specific DNA binding activity. Predicted to be involved in DNA methylation; histone deacetylation; and negative regulation of macromolecule metabolic process. Predicted to act upstream of or within chromatin organization and histone modification. Located in cytosol and nuclear speck.