A17609
UBE4B Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A17609
- Additional Names:
- E4|HDNB1|UBE4B|UBOX3|UFD2|UFD2A
- Application:
- ELISA, WB
- Molecular Weight:
- 146kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- EVDENDRREKRSLSDKEPSSGPEVSEEQALQLVCKIFRVSWKDRDRDVIFLSSLSAQFKQNPKEVFSDFKDLIGQILMEVLMMSTQTRDENPFASLTATSQPIAAAARSPDRNLLLNTGSN
- Uniprot:
- O95155
- Synonyms:
- E4;HDNB1;homologous to yeast UFD2;Homozygously deleted in neuroblastoma 1;homozygously deleted in neuroblastoma-1;RING-type E3 ubiquitin transferase E4 B;ubiquitin conjugation factor E4 B;Ubiquitin fusion degradation protein 2;ubiquitin-fusion degradation protein 2;ubiquitination factor E4B (UFD2 homolog, yeast);UBOX3;UFD2;UFD2A
- Extra Details:
- The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly. This gene is also the strongest candidate in the neuroblastoma tumor suppressor genes. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice

