RNF144A Rabbit polyclonal antibody

Size

£152.00

SKU:: A17597
Additional Names:: hUIP4|RNF144|RNF144A|UBCE7IP4|UIP4
Application:: ELISA, WB
Molecular Weight:: 38kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVCQLQDVGLQTPQPVQCKACRMEFCSTCKASWHPGQGCPETMPITFLPGETSAAFKMEEDD
Uniprot:: P50876
Synonyms:: E3 ubiquitin-protein ligase RNF144A;hUIP4;probable E3 ubiquitin-protein ligase RNF144A;ring finger protein 144;RING finger protein 144A;RNF144;UBCE7IP4;UbcM4-interacting protein 4;ubiquitin conjugating enzyme 7 interacting protein 4;Ubiquitin-conjugating enzyme 7-interacting protein 4;UIP4
Extra Details:: This gene encodes a member of a family of RING finger domain-containing E3 ubiquitin ligases that also includes parkin and parc. The expression of this gene is induced by DNA damage. The encoded protein interacts with the cytoplasmic DNA-dependent protein kinase, catalytic subunit (DNA-PKcs) and promotes its degradation through ubiquitination. The orthologous mouse protein has been shown to interact with a ubiquitin-conjugating enzyme involved in embryonic development.