COG1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A17594
Additional Names:: CDG2G|COG1|LDLB
Application:: ELISA, WB, IHC-P
Molecular Weight:: 109kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: DSRIEKVTDHLEALIDPFDLDVFTPHLNSNLHRLVQRTSVLFGLVTGTENQLAPRSSTFNSQEPHNILPLASSQIRFGLLPLSMTSTRKAKSTRNIETKAQ
Uniprot:: Q8WTW3
Synonyms:: CDG2G;COG complex subunit 1;Component of oligomeric Golgi complex 1;conserved oligomeric Golgi complex protein 1;conserved oligomeric Golgi complex subunit 1;LDLB;low density lipoprotein receptor defect B complementing
Extra Details:: The protein encoded by this gene is one of eight proteins (Cog1-8) which form a Golgi-localized complex (COG) required for normal Golgi morphology and function. It is thought that this protein is required for steps in the normal medial and trans Golgi-associated processing of glycoconjugates and plays a role in the organization of the Golgi-localized complex.