SYNJ1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A17581
Additional Names:: DEE53|EIEE53|INPP5G|PARK20|SYNJ1
Application:: ELISA, WB
Molecular Weight:: 140kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: GLLGVLRLNLGDTMLHYLVLVTGCMSVGKIQESEVFRVTSTEFISLRIDSSDEDRISEVRKVLNSGNFYFAWSASGISLDLSLNAHRSMQEQTTDNRFFWN
Uniprot:: O43426
Synonyms:: DEE53;EIEE53;inositol 5'-phosphatase (synaptojanin 1);inositol polyphosphate-5-phosphatase G;INPP5G;PARK20;phosphoinositide 5-phosphatase;synaptic inositol 1,4,5-trisphosphate 5-phosphatase 1;synaptojanin-1;synaptojanin-1, polyphosphoinositide phosphatase
Extra Details:: This gene encodes a phosphoinositide phosphatase that regulates levels of membrane phosphatidylinositol-4,5-bisphosphate. As such, expression of this enzyme may affect synaptic transmission and membrane trafficking. Multiple transcript variants encoding different isoforms have been found for this gene.