A17573
B4GALT2 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A17573
- Additional Names:
- B4Gal-T2|B4Gal-T3|B4GALT2|beta4Gal-T2
- Application:
- ELISA, WB
- Molecular Weight:
- 42kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- PGVLMGGRYTPPDCTPAQTVAVIIPFRHREHHLRYWLHYLHPILRRQRLRYGVYVINQHGEDTFNRAKLLNVGFLEALKEDAAYDCFIFSDVDLVPMDDRNLYRCGDQPRHFAIAMD
- Uniprot:
- O60909
- Synonyms:
- B4Gal-T2;B4Gal-T3;beta-1,4-galactosyltransferase 2;beta-1,4-GalTase 2;beta-4-GalT2;beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase 2;beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase;beta4Gal-T2;lactose synthase A protein;N-acetyllactosamine synthase;nal synthase;UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 2;UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 2;UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 2;UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 2
- Extra Details:
- This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. The enzyme encoded by this gene synthesizes N-acetyllactosamine in glycolipids and glycoproteins. Its substrate specificity is affected by alpha-lactalbumin but it is not expressed in lactating mammary tissue. Three transcript variants encoding two different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice

