NUF2 Rabbit monoclonal antibody

Size

POA

SKU:: A17553
Additional Names:: CDCA1|CT106|NUF2|NUF2R
Application:: ELISA, WB
Molecular Weight:: 54kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: METLSFPRYNVAEIVIHIRNKILTGADGKNLTKNDLYPNPKPEVLHMIYMRALQIVYGIRLEHFYMMPVNSEVMYPHLMEGFLPFSNLVTHLDSFLPICR
Uniprot:: Q9BZD4
Synonyms:: cancer/testis antigen 106;CDCA1;cell division cycle associated 1;cell division cycle-associated protein 1;CT106;hNuf2;hNuf2R;hsNuf2;kinetochore protein Nuf2;NDC80 kinetochore complex component NUF2;NUF2, NDC80 kinetochore complex component, homolog;NUF2R
Extra Details:: This gene encodes a protein that is highly similar to yeast Nuf2, a component of a conserved protein complex associated with the centromere. Yeast Nuf2 disappears from the centromere during meiotic prophase when centromeres lose their connection to the spindle pole body, and plays a regulatory role in chromosome segregation. The encoded protein is found to be associated with centromeres of mitotic HeLa cells, which suggests that this protein is a functional homolog of yeast Nuf2. Alternatively spliced transcript variants that encode the same protein have been described.