ZIC1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A17547
Additional Names:: BAIDCS|CRS6|ZIC|ZIC1|ZNF201
Application:: ELISA, WB
Molecular Weight:: 48kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LFAASAGGFGGPHGHTDAAGHLLFPGLHEQAAGHASPNVVNGQMRLGFSGDMYPRPEQYGQVTSPRSEHYAAPQLHGYGPMNVNMAAHHGA
Uniprot:: Q15915
Synonyms:: BAIDCS;CRS6;ZIC;Zic family member 1 (odd-paired homolog, Drosophila);zinc finger protein 201;Zinc finger protein of the cerebellum 1;zinc finger protein ZIC 1;ZNF201
Extra Details:: This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development. Aberrant expression of this gene is seen in medulloblastoma, a childhood brain tumor. This gene is closely linked to the gene encoding zinc finger protein of the cerebellum 4, a related family member on chromosome 3. This gene encodes a transcription factor that can bind and transactivate the apolipoprotein E gene.