POU3F4 Rabbit polyclonal antibody

Size

£152.00

SKU:: A17521
Additional Names:: BRAIN-4|BRN-4|BRN4|DFN3|DFNX2|OCT-9|OTF-9|OTF9|POU3F4
Application:: ELISA, WB
Molecular Weight:: 39kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MATAASNPYSILSSTSLVHADSAGMQQGSPFRNPQKLLQSDYLQGVPSNGHPLGHHWVTSLSDGGPWSSTLATSPLDQQDVKPGREDLQLGAIIHHRSPHVAHHSPHTNHPNAWGASPAPNPSITSSGQPLNVYSQPGFTVSGMLEHGGLTPPPAAASAQSLHPVLREPPDHGELGSHHCQDHSDEETPT
Uniprot:: P49335
Synonyms:: BRAIN-4;brain-specific homeobox/POU domain protein 4;BRN-4;BRN4;DFN3;DFNX2;OCT-9;Octamer-binding protein 9;octamer-binding transcription factor 9;OTF-9;OTF9;POU domain, class 3, transcription factor 4
Extra Details:: This gene encodes a member of the POU-III class of neural transcription factors. This family member plays a role in inner ear development. The protein is thought to be involved in the mediation of epigenetic signals which induce striatal neuron-precursor differentiation. Mutations in this gene are associated with X chromosome-linked nonsyndromic mixed deafness.