CDK18 Rabbit polyclonal antibody

Size

£152.00

SKU:: A17515
Additional Names:: CDK18|PCTAIRE|PCTAIRE3|PCTK3
Application:: ELISA, WB
Molecular Weight:: 54kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: EFRTYSFPCYLPQPLINHAPRLDTDGIHLLSSLLLYESKSRMSAEAALSHSYFRSLGERVHQLEDTASIFSLKEIQLQKDPGYRGLAFQQPGRGKNRRQSIF
Uniprot:: Q07002
Synonyms:: cell division protein kinase 18;cyclin-dependent kinase 18;PCTAIRE;PCTAIRE protein kinase 3;PCTAIRE-motif protein kinase 3;PCTAIRE3;PCTK3;serine/threonine-protein kinase PCTAIRE-3
Extra Details:: Predicted to enable ATP binding activity; cyclin-dependent protein serine/threonine kinase activity; and protein serine kinase activity. Predicted to be involved in protein phosphorylation and regulation of transcription involved in G1/S transition of mitotic cell cycle. Predicted to be active in cytoplasm and nucleus.