A17508
MAK Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A17508
- Additional Names:
- MAK|RP62
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 71kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- TLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKD
- Uniprot:
- P20794
- Synonyms:
- Male germ cell-associated kinase;RP62;serine/threonine protein kinase MAK;serine/threonine-protein kinase MAK;testicular secretory protein Li 28
- Extra Details:
- The product of this gene is a serine/threonine protein kinase related to kinases involved in cell cycle regulation. Studies of the mouse and rat homologs have localized the kinase to the chromosomes during meiosis in spermatogenesis, specifically to the synaptonemal complex that exists while homologous chromosomes are paired. Mutations in this gene have been associated with ciliary defects resulting in retinitis pigmentosa 62. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice