A17506
LAD1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A17506
- Additional Names:
- LAD1|LadA
- Application:
- ELISA, WB
- Molecular Weight:
- 54kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- TTDDEAPRLSQNGDRQASASERLPSVEEAEVPKPLPPASKDEDEDIQSILRTRQERRQRRQVVEAAQAPIQERLEAEEGRNSLSPVQATQKPLVSKKELEIPPRRRLSREQRGPWALEEESLVGREPEERKKGVPEKSPVLEKSSMPKKTAPEKSLVSDKT
- Uniprot:
- O00515
- Synonyms:
- lad-1;LadA;ladinin-1;linear IgA bullous dermatosis antigen;Linear IgA disease antigen;linear IgA disease antigen homolog
- Extra Details:
- The protein encoded by this gene may be an anchoring filament that is a component of basement membranes. It may contribute to the stability of the association of the epithelial layers with the underlying mesenchyme.
- Shipping Conditions:
- Blue Ice