A17502
ITGA3 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A17502
- Additional Names:
- CD49C|FRP-2|GAP-B3|GAPB3|ILNEB|ITGA3|JEB7|MSK18|VCA-2|VL3A|VLA3a
- Application:
- ELISA, WB
- Molecular Weight:
- 125kDa/130kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- TNRTGAVYLCPLTAHKDDCERMNITVKNDPGHHIIEDMWLGVTVASQGPAGRVLVCAHRYTQVLWSGSEDQRRMVGKCYVRGNDLELDSSDDWQTYHNEMCNSNTDYLETGMCQLGTSGGFTQNTVYFGAPGAYNWKGNSYMIQRKEWDLSEYSYKDPEDQGNLYIGYTMQVGSFI
- Uniprot:
- P26006
- Synonyms:
- alpha 3 subunit of VLA-3 receptor;antigen CD49C;antigen identified by monoclonal antibody J143;CD49 antigen-like family member C;CD49C;FRP-2;galactoprotein B3;GAP-B3;GAPB3;ILNEB;integrin alpha 3;integrin alpha-3;integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor);MSK18;testicular tissue protein Li 96;testicular tissue protein Li 98;VCA-2;very late activation protein 3 receptor, alpha-3 subunit;VL3A;VLA-3 subunit alpha;VLA3a
- Extra Details:
- The gene encodes a member of the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain that function as cell surface adhesion molecules. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha 3 subunit. This subunit joins with a beta 1 subunit to form an integrin that interacts with extracellular matrix proteins including members of the laminin family. Expression of this gene may be correlated with breast cancer metastasis.
- Shipping Conditions:
- Blue Ice



