A17461
COL9A2 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A17461
- Additional Names:
- COL9A2|DJ39G22.4|EDM2|MED|STL5
- Application:
- ELISA, WB
- Molecular Weight:
- 65kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- RGEKGDPGEVGRGHPGMPGPPGIPGLPGRPGQAINGKDGDRGSPGAPGEAGRPGLPGPVGLPGFCEPAACLGASAYASARLTEPGSIKGP
- Uniprot:
- Q14055
- Synonyms:
- alpha 2 type IX collagen;collagen alpha-2(IX) chain;collagen IX, alpha-2 polypeptide;collagen, type IX, alpha 2;DJ39G22.4;EDM2;MED;STL5
- Extra Details:
- This gene encodes one of the three alpha chains of type IX collagen, the major collagen component of hyaline cartilage. Type IX collagen, a heterotrimeric molecule, is usually found in tissues containing type II collagen, a fibrillar collagen. This chain is unusual in that, unlike the other two type IX alpha chains, it contains a covalently attached glycosaminoglycan side chain. Mutations in this gene are associated with multiple epiphyseal dysplasia.
- Shipping Conditions:
- Blue Ice

