CNTN1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A17459
Additional Names:: CMYP12|CNTN1|F3|GP135|MYPCN
Application:: ELISA, WB, IHC-P
Molecular Weight:: 130kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LECFALGNPVPDIRWRKVLEPMPSTAEISTSGAVLKIFNIQLEDEGIYECEAENIRGKDKHQARIYVQAFPEWVEHINDTEVDIGSDLYWPCVATGKPIPT
Uniprot:: Q12860
Synonyms:: contactin-1;F3;glycoprotein gP135;GP135;MYPCN;neural cell surface protein F3
Extra Details:: The protein encoded by this gene is a member of the immunoglobulin superfamily. It is a glycosylphosphatidylinositol (GPI)-anchored neuronal membrane protein that functions as a cell adhesion molecule. It may play a role in the formation of axon connections in the developing nervous system. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.