CHRNA5 Rabbit polyclonal antibody

Size

£152.00

SKU:: A1741
Additional Names:: CHRNA5|LNCR2
Application:: ELISA, WB
Molecular Weight:: 50kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: RCGLAGAAGGAQRGLSEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTPDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYV
Uniprot:: P30532
Synonyms:: acetylcholine receptor, nicotinic, alpha 5 (neuronal);Cholinergic receptor, neuronal nicotinic, alpha polypeptide-5;cholinergic receptor, nicotinic alpha 5;cholinergic receptor, nicotinic, alpha 5 (neuronal);LNCR2;neuronal acetylcholine receptor subunit alpha-5;neuronal nicotinic acetylcholine receptor, alpha5 subunit
Extra Details:: The protein encoded by this gene is a nicotinic acetylcholine receptor subunit and a member of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. These receptors are thought to be heteropentamers composed of separate but similar subunits. Defects in this gene have been linked to susceptibility to lung cancer type 2 (LNCR2).