RUNX1T1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A1737
Additional Names:: AML1-MTG8|AML1T1|CBFA2T1|CDR|ETO|MTG8|RUNX1T1|ZMYND2
Application:: ELISA, WB
Molecular Weight:: 68kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAEDLK
Uniprot:: Q06455
Synonyms:: acute myelogenous leukemia 1 translocation 1, cyclin-D related;AML1-MTG8;AML1T1;CBFA2T1;CDR;core-binding factor, runt domain, alpha subunit 2; translocated to, 1; cyclin D-related;Cyclin-D-related protein;eight twenty one protein;ETO;MTG8;myeloid translocation gene on 8q22;protein CBFA2T1;Protein ETO;Protein MTG8;runt related transcription factor 1; translocated to, 1 (cyclin D related);RUNX1 translocation partner 1;zinc finger MYND domain-containing protein 2;ZMYND2
Extra Details:: This gene encodes a member of the myeloid translocation gene family which interact with DNA-bound transcription factors and recruit a range of corepressors to facilitate transcriptional repression. The t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities in acute myeloid leukemia. The translocation produces a chimeric gene made up of the 5'-region of the runt-related transcription factor 1 gene fused to the 3'-region of this gene. The chimeric protein is thought to associate with the nuclear corepressor/histone deacetylase complex to block hematopoietic differentiation. Alternative splicing results in multiple transcript variants.

Shipping Conditions:: Blue Ice