A17351
FOS Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A17351
- Additional Names:
- AP-1|C-FOS|FOS|p55
- Application:
- ELISA, WB
- Molecular Weight:
- 62kDa
- Species Reactivity:
- Human, Mouse, Rat
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPA
- Uniprot:
- P01100
- Synonyms:
- activator protein 1;AP-1;C-FOS;cellular oncogene c-fos;Cellular oncogene fos;FBJ murine osteosarcoma viral (v-fos) oncogene homolog (oncogene FOS);FBJ murine osteosarcoma viral oncogene homolog;Fos proto-oncogene, AP-1 trancription factor subunit;G0/G1 switch regulatory protein 7;p55;proto-oncogene c-Fos
- Extra Details:
- The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of the FOS gene has also been associated with apoptotic cell death.
- Shipping Conditions:
- Blue Ice

