A17330
NCOA3 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A17330
- Additional Names:
- ACTR|AIB-1|AIB1|bHLHe42|CAGH16|CTG26|KAT13B|NCOA3|pCIP|RAC3|SRC-3|SRC3|TNRC14|TNRC16|TRAM-1
- Application:
- ELISA, WB, IP
- Molecular Weight:
- 160kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSGLGENLDPLASDSRKRKLPCDTPGQGLTCSGEKRRREQESKYIEELAELISANLSDIDNFNVKPDKCAILKETVRQIRQIKEQGKTISNDDDVQKADV
- Uniprot:
- Q9Y6Q9
- Synonyms:
- ACTR;AIB-1;AIB1;amplified in breast cancer 1 protein;bHLHe42;CAGH16;CBP-interacting protein;class E basic helix-loop-helix protein 42;CTG26;KAT13B;nuclear receptor coactivator 3;pCIP;RAC3;receptor-associated coactivator 3;SRC-3;SRC3;steroid receptor coactivator protein 3;thyroid hormone receptor activator molecule 1;TNRC14;TNRC16;TRAM-1
- Extra Details:
- The protein encoded by this gene is a nuclear receptor coactivator that interacts with nuclear hormone receptors to enhance their transcriptional activator functions. The encoded protein has histone acetyltransferase activity and recruits p300/CBP-associated factor and CREB binding protein as part of a multisubunit coactivation complex. This protein is initially found in the cytoplasm but is translocated into the nucleus upon phosphorylation. Several transcript variants encoding different isoforms have been found for this gene. In addition, a polymorphic repeat region is found in the C-terminus of the encoded protein.
- Shipping Conditions:
- Blue Ice



